Anti-C4BPB

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58374.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Controls the classical pathway of complement activation. It binds as a cofactor... more

Close menu

Product information "Anti-C4BPB"

Protein function: Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. It also interacts with anticoagulant protein S and with serum amyloid P component. The beta chain binds protein S. [The UniProt Consortium]

Keywords:	Anti-C4BPB, Anti-C4b-binding protein beta chain
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58374

Properties

Application:	IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: dog, swine)
Immunogen:	Synthetic peptide around the N-terminal region of Human C4BPB. (within the following sequence: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV)
MW:	28 kD
Format:	Affinity Purified