Anti-BD2, aa4-41 (beta Defensin-2)

Anti-BD2, aa4-41 (beta Defensin-2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
B0901-01C.20 20 µl - -

3 - 19 business days*

416.00€
B0901-01C.100 100 µl - -

3 - 19 business days*

848.00€
 
Applications: |Suitable for use in ELISA. Other applications not tested.||Recommended... more
Product information "Anti-BD2, aa4-41 (beta Defensin-2)"
Applications: , Suitable for use in ELISA. Other applications not tested. Recommended Dilution: ELISA: 1:5000, Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Anti-BD-2, Anti-SAP1, Anti-hBD-2, Anti-DEFB4A, Anti-DEFB102, Anti-Beta-defensin 2, Anti-Beta-defensin 4A, Anti-Defensin, beta 2, Anti-Skin-antimicrobial peptide 1
Supplier: United States Biological
Supplier-Nr: B0901-01C

Properties

Application: ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Sheep
Species reactivity: human
Immunogen: Synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Format: Serum

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-BD2, aa4-41 (beta Defensin-2)"
Write a review
or to review a product.
Viewed