Anti-Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor, Atrial natriuret

Anti-Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor, Atrial natriuret
Item number Size Datasheet Manual SDS Delivery time Quantity Price
A4153-03.20 20 µl - -

3 - 19 business days*

338.00€
A4153-03.100 100 µl - -

3 - 19 business days*

858.00€
 
Applications: |Suitable for use in ELISA, RIA. Other applications not tested.||Recommended... more
Product information "Anti-Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor, Atrial natriuret"
Applications: , Suitable for use in ELISA, RIA. Other applications not tested. Recommended Dilution: RIA: 1:5000, Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplier: United States Biological
Supplier-Nr: A4153-03

Properties

Antibody Type: Polyclonal
Conjugate: No
Host: Sheep
Species reactivity: human
Immunogen: Synthetic human pro-ANP (aa 1-30) polylysine conjugated(NPMYNAVSNADLMDFKNLLDHLEEKMPLED)
Format: Serum

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor, Atrial natriuret"
Write a review
or to review a product.
Viewed