Anti-Ataxin 1, clone S76-8

Anti-Ataxin 1, clone S76-8
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG22248.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Chromatin-binding factor that repress Notch signaling in the absence of Notch... more
Product information "Anti-Ataxin 1, clone S76-8"
Protein function: Chromatin-binding factor that repress Notch signaling in the absence of Notch intracellular domain by acting as a CBF1 corepressor. Binds to the HEY promoter and might assist, along with NCOR2, RBPJ-mediated repression. May be involved in RNA metabolism. [The UniProt Consortium]
Keywords: Anti-Sca1, Anti-Atxn1, Anti-Ataxin-1, Anti-Spinocerebellar ataxia type 1 protein homolog
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG22248

Properties

Application: WB, IHC, IP
Antibody Type: Monoclonal
Clone: S76-8
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide around aa. 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of Mouse Ataxin 1.Rat: 100% identity (34/34 amino acids identical).Human: 88% identity (30/34 amino acids identical)
MW: 85 kD
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Ataxin 1, clone S76-8"
Write a review
or to review a product.
Viewed