Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)

Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
123601.100 100 µg - -

3 - 19 business days*

699.00€
 
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB)... more
Product information "Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)"
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene but some of the full length sequences are not known. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPDDDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 123601

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: 2G11
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ASB4 (Ankyrin Repeat and SOCS Box Protein 4, ASB-4)"
Write a review
or to review a product.
Viewed