Anti-ARID1A

Anti-ARID1A
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59223.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Involved in transcriptional activation and repression of select genes by... more
Product information "Anti-ARID1A"
Protein function: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. [The UniProt Consortium]
Keywords: Anti-hELD, Anti-B120, Anti-hOSA1, Anti-BAF250, Anti-ARID1A, Anti-BAF250A, Anti-Osa homolog 1, Anti-SWI-like protein, Anti-BRG1-associated factor 250, Anti-BRG1-associated factor 250a, Anti-SWI/SNF complex protein p270
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59223

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: hamster)
Immunogen: Synthetic peptide corresponding to aa. 1021-1053 of Human ARID1A. (KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR)
MW: 242 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ARID1A"
Write a review
or to review a product.
Viewed