Anti-ARHGEF1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59029.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Seems to play a role in the regulation of RhoA GTPase by guanine... more
Product information "Anti-ARHGEF1"
Protein function: Seems to play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13) subunits. Acts as GTPase-activating protein (GAP) for GNA12 and GNA13, and as guanine nucleotide exchange factor (GEF) for RhoA GTPase. Activated G alpha 13/GNA13 stimulates the RhoGEF activity through interaction with the RGS-like domain. This GEF activity is inhibited by binding to activated GNA12. Mediates angiotensin-2- induced RhoA activation. [The UniProt Consortium]
Keywords: Anti-Sub1.5, Anti-ARHGEF1, Anti-p115RhoGEF, Anti-p115-RhoGEF, Anti-Rho guanine nucleotide exchange factor 1, Anti-115 kDa guanine nucleotide exchange factor
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59029

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: hamster)
Immunogen: Synthetic peptide corresponding to aa. 41-71 of Human ARHGEF1 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE)
MW: 102 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ARHGEF1"
Write a review
or to review a product.
Viewed