Anti-AP3D1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59758.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Part of the AP-3 complex, an adaptor-related complex which is not... more

Close menu

Product information "Anti-AP3D1"

Protein function: Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. Involved in process of CD8+ T-cell and NK cell degranulation (PubMed:26744459). In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. [The UniProt Consortium]

Keywords:	Anti-AP3D1, Anti-PRO0039, Anti-Delta-adaptin, Anti-AP-3 complex subunit delta, Anti-AP-3 complex subunit delta-1, Anti-Adaptor-related protein complex 3 subunit delta-1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59758

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide around the middle region of Human AP3D1. (within the following region: RHSSLPTESDEDIAPAQQVDIVTEEMPENALPSDEDDKDPNDPYRALDID)
MW:	130 kD
Format:	Affinity Purified