Anti-Annexin VIII

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32683 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ANXA8 is also known as Annexin VIII. This... more
Product information "Anti-Annexin VIII"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10. Protein function: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. [The UniProt Consortium]
Keywords: Anti-ANX8, Anti-VAC-beta, Anti-Annexin-8, Anti-Annexin A8, Anti-Annexin VIII, Anti-Vascular anticoagulant-beta, Annexin VIII Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32683

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Annexin VIII"
Write a review
or to review a product.
Viewed