Anti-Annexin A4

Anti-Annexin A4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58211.50 50 µg - -

6 - 14 business days*

508.00€
 
Protein function: Calcium/phospholipid-binding protein which promotes membrane fusion and is... more
Product information "Anti-Annexin A4"
Protein function: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. [The UniProt Consortium]
Keywords: Anti-ANX4, Anti-ANXA4, Anti-PP4-X, Anti-P32.5, Anti-PAP-II, Anti-Annexin-4, Anti-Protein II, Anti-Annexin IV, Anti-Annexin A4, Anti-Endonexin I, Anti-Lipocortin IV, Anti-Chromobindin-4, Anti-35-beta calcimedin, Anti-Placental anticoagulant protein II
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58211

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence in the middle region of Human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related Mouse and Rat sequences by three amino acids
MW: 36 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Annexin A4"
Write a review
or to review a product.
Viewed