Anti-AKAP5

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41262.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: May anchor the PKA protein to cytoskeletal and/or organelle-associated... more

Close menu

Product information "Anti-AKAP5"

Protein function: May anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. Association with to the beta2-adrenergic receptor (beta2-AR) not only regulates beta2-AR signaling pathway, but also the activation by PKA by switching off the beta2-AR signaling cascade. [The UniProt Consortium]

Keywords:	Anti-H21, Anti-AKAP5, Anti-AKAP-5, Anti-AKAP79, Anti-AKAP 79, Anti-A-kinase anchor protein 5, Anti-A-kinase anchor protein 79 kDa, Anti-cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41262

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, cow, dog, horse, swine, yeast)
Immunogen:	Synthetic peptide around the middle region of Human AKAP5. (within the following region: KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE)
MW:	47 kD
Format:	Affinity Purified