Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
253921.100 | 100 µl | - | - |
3 - 19 business days* |
750.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Ajuba (an Urdu word meaning "curiosity") is a 55-60kD member of the Zyxin/Ajuba family of... more
Product information "Anti-Ajuba (Jub, MGC15563, Protein ajuba)"
Ajuba (an Urdu word meaning "curiosity") is a 55-60kD member of the Zyxin/Ajuba family of proteins. Ajuba is found in keratinocytes, astrocytes and neurons, and exhibits multiple functions. It shuttles between the nucleus and cytosol, and participates in alpha- catenin:F-actin binding, beta-catenin binding and phosphorylation, p62 aPKC scaffold protein binding and NF-kappaB activation, and Aurora-A binding and phosphorylation. Human Ajuba is 538aa in length. It contains a Pro-rich preLIM region that binds actin and Grb2 (aa1-335), an NES (aa280 -287), and three LIM domains that bind multiple proteins (aa336-397, 401-461 and 462-530). Ajuba is a LIM domain protein suggested to bind and regulate the activity of Aurora A. Aurora A, which is involved in cell cycle regulation, is upregulated during mitosis, localizing to the centrosomes and microtubule regions proximal to the centrosomes. Applications: Suitable for use in Western Blot, Immunoprecipitation. Other applications not tested. Recommended Dilution: Western Blot: 1:100. Predicted molecular weight: 57kD, Optimal dilutions to be determined by the researcher. Hybridoma: NS1 myeloma cells with spleen cells from Balb/c mice. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: | United States Biological |
Supplier-Nr: | 253921 |
Properties
Application: | IP, WB |
Antibody Type: | Monoclonal |
Clone: | 21G4 |
Conjugate: | No |
Host: | Mouse |
Species reactivity: | human |
Immunogen: | Full length Human Ajuba fused to maltose binding protein. MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSG LGGPRKSGPRGATGGPGDEPLEPAREQGSLDAERNQRGSF EAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSP RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSN RTSGISMGYDQRHGSPLPAGPCLFGPPLAGAPA |
Format: | Affinity Purified |
Database Information
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed