CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
E-PKSM041515.20	20 µg		-		7 - 16 business days*		295.00€
E-PKSM041515.100	100 µg		-		7 - 16 business days*		877.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The... more

Close menu

Product information "CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)"

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <1 µg/mL. Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function:

Keywords:	Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys, Recombinant Mouse CXCL7 (40-113) protein(N-His)(active)
Supplier:	Elabscience
Supplier-Nr:	E-PKSM041515

Properties

Application:	Active, Cell culture
Conjugate:	No
Host:	E.coli
Species reactivity:	mouse
MW:	13.08 kD
Format:	Lyophilized

Database Information

KEGG ID :	K10029 \| Matching products
UniProt ID :	Q9EQI5 \| Matching products
Gene ID	GeneID 57349 \| Matching products

Handling & Safety

Storage:	-80°C
Shipping:	4°C (International: -20°C)

Caution
Our products are for laboratory research use only: Not for administration to humans!

Information about the product reference will follow. more

Close menu

View product citations for antibody E-PKSM041515 on CiteAb

You will get a certificate here

Go back

Read, write and discuss reviews... more

Close menu

Customer review for "CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)"

Write a review