12 products were found matching "Q9EQI5"!

Sequence: KSDGMDPYIE LRCRCTNTIS GIPFNSISLV NVYRPGVHCA DVEVIATLKN GQKTCLDPNA PGVKRIVMKI with polyhistidine tag at the N-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method.

Sequence: IELRCRCTNT ISGIPFNSIS LVNVYRPGVH CADVEVIATL KNGQKTCLDP NAPGVKRIVM with polyhistidine tag at the N-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method.

Matched antibody pair.

Type: Sandwich. Detection Range: 3.13~200pg/mL. Sensitivity: 1.88pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse beta-TG . Standards or...

Colormetric. Detection Range: 31.25-2000 pg/mL.

Produced in Yeast. Amino acid sequence: KSDGMDPYIE LRCRCTNTIS GIPFNSISLV NVYRPGVHCA DVEVIATLKN GQKTCLDPNA PGVKRIVMKI LEGY (74).

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Chemokine (C-X-C motif) ligand 7 (CXCL7), also known as NAP2 or Pro-Platelet basic protein (PPBP), is a human gene. The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent...

Beta-Thromboglobulin (bTG) BioAssay(TM) ELISA Kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of bTG in mouse serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Detection Range: 1.56-100pg/ml, Sensitivity: 0.69pg/ml, Intra-Assay CV: <10%,...

Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9EQI5, Fragment: Lys40~Tyr113 (Accession No: Q9EQI5), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-K SDGMDPYIEL RCRCTNTISG IPFNSISLVN VYRPGVHCAD VEVIATLKNG QKTCLDPNAP GVKRIVMKIL EGY,...

Type: Sandwich. Detection Range: 3.13~200pg/mL. Sensitivity: 1.88pg/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse beta-TG . Standards or...

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <1 µg/mL. Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by...

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL. Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by...