Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)

Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.