6 products were found matching "P56386"!

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse DEFb1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse DEFb1. Next,...

Mouse recombinant BD 1 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 37 amino acids and having a molecular mass of 4.1 kDa. The Defensin family are highly similar in their protein sequence and are microbicidal and cytotoxic peptides made by neutrophils. Beta Defensin-1 is an...

Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of DEFb1 in mouse serum, plasma and other biological fluids. Detection Range: 0.78-50ng/ml, Sensitivity: 0.28ng/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...

Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P56386, Fragment: Val22~Ser69 (Accession No: P56386), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-VGILTSLGR RTDQYKCLQH GGFCLRSSCP SNTKLQGTCK PDKPNCCKS, Epitope Tag:...

Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...