- Search results for P56386
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
6 products were found matching "P56386"!
Close filters
Filter by:
No results were found for the filter!
Item number: ELK-ELK2248.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse DEFb1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse DEFb1. Next,...
Keywords: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1 |
Application: | ELISA |
Species reactivity: | mouse |
From 365.00€
*
Item number: 97410.1
Mouse recombinant BD 1 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 37 amino acids and having a molecular mass of 4.1 kDa. The Defensin family are highly similar in their protein sequence and are microbicidal and cytotoxic peptides made by neutrophils. Beta Defensin-1 is an...
Keywords: | Beta-defensin 1, BD-1, Defensin beta 1, hBD-1, HBD1, HBP1, DEFB1, HBD-1, HBP-1, DEFB101, DEFB-1, MGC51822. |
Application: | Cell Culture |
Expressed in: | E.coli |
Origin: | mouse |
MW: | 4100 D |
From 94.00€
*
Item number: G-MOFI00227.96
Application: | ELISA |
Species reactivity: | mouse |
694.00€
*
Item number: 024598.96
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of DEFb1 in mouse serum, plasma and other biological fluids. Detection Range: 0.78-50ng/ml, Sensitivity: 0.28ng/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
Keywords: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1 |
Application: | ELISA |
Species reactivity: | mouse |
987.00€
*
Item number: 154319.10
Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P56386, Fragment: Val22~Ser69 (Accession No: P56386), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-VGILTSLGR RTDQYKCLQH GGFCLRSSCP SNTKLQGTCK PDKPNCCKS, Epitope Tag:...
From 381.00€
*
Item number: 372437.100
Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
Keywords: | BD-1, mBD-1, Defb1, Beta-defensin 1, Defensin, beta 1 |
MW: | 20,1 |
From 636.00€
*