The following products have been found matching your search "P56386": 5

No results were found for the filter!
Beta Defensin-1, mouse recombinant (rHuBD-1)
Beta Defensin-1, mouse recombinant (rHuBD-1)

Item number: 97410.1

Mouse recombinant BD 1 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 37 amino acids and having a molecular mass of 4.1 kDa. The Defensin family are highly similar in their protein sequence and are microbicidal and cytotoxic peptides made by neutrophils. Beta Defensin-1 is an...
Keywords: Beta-defensin 1, BD-1, Defensin beta 1, hBD-1, HBD1, HBP1, DEFB1, HBD-1, HBP-1, DEFB101, DEFB-1, MGC51822.
Application: Cell Culture
Reactivity: Mouse
MW: 4100 D
Please request pricing for this article.
Review
Mouse BD-1 / beta Defensin 1 ELISA Kit
Mouse BD-1 / beta Defensin 1 ELISA Kit

Item number: G-MOFI00227.96

Application: ELISA
Reactivity: Mouse
629.00€ *
Review
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse)
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse)

Item number: 024598.96

Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of DEFb1 in mouse serum, plasma and other biological fluids. Detection Range: 0.78-50ng/ml, Sensitivity: 0.28ng/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
Keywords: BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1
Application: ELISA
Reactivity: Mouse
833.00€ *
Review
Defensin Beta 1 (DEFb1) Recombinant, Mouse
Defensin Beta 1 (DEFb1) Recombinant, Mouse

Item number: 154319.10

Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P56386, Fragment: Val22~Ser69 (Accession No: P56386), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-VGILTSLGR RTDQYKCLQH GGFCLRSSCP SNTKLQGTCK PDKPNCCKS, Epitope Tag:...
From 314.00€ *
Review
Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)
Beta-defensin 1, Recombinant, Mouse, aa33-69,...

Item number: 372437.10

Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
Keywords: BD-1, mBD-1, Defb1, Beta-defensin 1, Defensin, beta 1
MW: 20,1
From 449.00€ *
Review