Anti-SMC3, clone 4C12

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59233.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Central component of cohesin, a complex required for chromosome cohesion during... more

Close menu

Product information "Anti-SMC3, clone 4C12"

Protein function: Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement. [The UniProt Consortium]

Keywords:	Anti-BAM, Anti-SMC3, Anti-hCAP, Anti-SMC-3, Anti-Bamacan, Anti-SMC protein 3, Anti-Chromosome-associated polypeptide, Anti-Chondroitin sulfate proteoglycan 6, Anti-Structural maintenance of chromosomes protein 3
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59233

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Monoclonal
Clone:	4C12
Conjugate:	No
Host:	Mouse
Species reactivity:	human
Immunogen:	Synthetic peptide corresponding to aa. 1178-1216 of Human SMC3. (ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH)
MW:	141 kD
Format:	Antigen Affinity Purified