Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-RQ4493 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Structural maintenance of chromosomes 3,... more
Product information "Anti-SMC3, clone 4C12"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein. Protein function: Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement. [The UniProt Consortium]
Keywords: | Anti-BAM, Anti-SMC3, Anti-hCAP, Anti-SMC-3, Anti-Bamacan, Anti-SMC protein 3, Anti-Chromosome-associated polypeptide, Anti-Chondroitin sulfate proteoglycan 6, Anti-Structural maintenance of chromosomes protein 3, SMC3 Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | RQ4493 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Monoclonal |
Clone: | 4C12 |
Conjugate: | No |
Host: | Mouse |
Species reactivity: | human |
Immunogen: | Amino acids ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH |
Format: | Purified |
Database Information
KEGG ID : | K06669 | Matching products |
UniProt ID : | Q9UQE7 | Matching products |
Gene ID | GeneID 9126 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed