Anti-SFTPB / Prosurfactant Protein B

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59105.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Pulmonary surfactant-associated proteins promote alveolar stability by lowering... more

Close menu

Product information "Anti-SFTPB / Prosurfactant Protein B"

Protein function: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air- liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. [The UniProt Consortium]

Keywords:	Anti-SP-B, Anti-SFTPB, Anti-SFTP3, Anti-6 kDa protein, Anti-18 kDa pulmonary-surfactant protein, Anti-Pulmonary surfactant-associated protein B, Anti-Pulmonary surfactant-associated proteolipid SPL(Phe)
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59105

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat)
Immunogen:	Synthetic peptide corresponding to a sequence of Human SFTPB / Prosurfactant Protein B. (QCLAERYSVILLDTLLGRMLPQLVCRLVLR)
MW:	42 kD
Format:	Affinity Purified