Anti-SFTPB / Pulmonary surfactant-associated protein B

Anti-SFTPB / Pulmonary surfactant-associated protein B
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4213 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pulmonary surfactant-associated protein B... more
Product information "Anti-SFTPB / Pulmonary surfactant-associated protein B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pulmonary surfactant-associated protein B is a protein that in humans is encoded by the SFTPB gene. This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified. Protein function: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air- liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. [The UniProt Consortium]
Keywords: Anti-SP-B, Anti-SFTP3, Anti-SFTPB, Anti-6 kDa protein, Anti-18 kDa pulmonary-surfactant protein, Anti-Pulmonary surfactant-associated protein B, Anti-Pulmonary surfactant-associated proteolipid SPL(Phe), SFTPB Antibody / Pulmonary surfactant-associated pr
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4213

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QCLAERYSVILLDTLLGRMLPQLVCRLVLR were used as the immunogen for the SFTPB antibody.
Format: Purified

Database Information

UniProt ID : P07988 | Matching products
Gene ID GeneID 6439 | Matching products

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SFTPB / Pulmonary surfactant-associated protein B"
Write a review
or to review a product.
Viewed