Anti-RBM38 (RNA Binding Motif Protein 38, HSRNASEB, RNPC1, SEB4B, SEB4D, dJ800J21.2)

Mouse polyclonal antibody raised against a full-length human RBM38 protein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRMouse polyclonal antibody raised against a full-length human RBM38 protein.ERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSMouse polyclonal antibody raised against a full-length human RBM38 protein.PAGTTFVQYQAPQLQPDRMQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.