Anti-NQO1

Anti-NQO1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31977 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene is a member of the NAD(P)H... more
Product information "Anti-NQO1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Protein function: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. [The UniProt Consortium]
Keywords: Anti-QR1, Anti-DTD, Anti-NQO1, Anti-DIA4, EC=1.6.5.2, Anti-Azoreductase, Anti-DT-diaphorase, Anti-Quinone reductase 1, Anti-Menadione reductase, Anti-Phylloquinone reductase, Anti-NAD(P)H:quinone oxidoreductase 1, Anti-NAD(P)H dehydrogenase [quinone] 1, N
Supplier: NSJ Bioreagents
Supplier-Nr: R31977

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK of human NQO1 were used as the immunogen for the NQO1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-NQO1"
Write a review
or to review a product.
Viewed