Anti-NQO1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40280.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: The enzyme apparently serves as a quinone reductase in connection with... more

Close menu

Product information "Anti-NQO1"

Protein function: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. [The UniProt Consortium]

Keywords:	Anti-DTD, Anti-QR1, Anti-DIA4, Anti-NQO1, EC=1.6.5.2, Anti-Azoreductase, Anti-DT-diaphorase, Anti-Quinone reductase 1, Anti-Menadione reductase, Anti-Phylloquinone reductase, Anti-NAD(P)H:quinone oxidoreductase 1, Anti-NAD(P)H dehydrogenase [quinone] 1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40280

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Synthetic peptide corresponding to aa. 242-274 of Human NQO1. (EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK)
MW:	31 kD
Format:	Antigen Affinity Purified