Anti-KIF3B

Anti-KIF3B
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41257.50 50 µl - -

10 - 15 business days*

584.00€
 
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome... more
Product information "Anti-KIF3B"
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
Keywords: Anti-KIF3B, Anti-KIAA0359
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41257

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Synthetic peptide around the C-terminal region of Human KIF3B. (within the following region: SGGGGEEEEEEGEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEE)
MW: 82 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-KIF3B"
Write a review
or to review a product.
Viewed