9 products were found matching "K20196"!
No results were found for the filter!
Anti-KIF3B
Item number: ARG41257.50
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
| Keywords: | Anti-KIF3B, Anti-KIAA0359 |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
584.00€
*
Anti-KIF3B
Item number: ATA-HPA066525.100
Polyclonal Antibody against Human KIF3B, Gene description: kinesin family member 3B, Alternative Gene Names: FLA8, KIAA0359, KLP-11, Validated applications: ICC, WB, Uniprot ID: O15066, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in tethering...
| Keywords: | Anti-KIF3B, Anti-KIAA0359 |
| Application: | ICC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-KIF3B
Item number: ATA-HPA066525.25
Polyclonal Antibody against Human KIF3B, Gene description: kinesin family member 3B, Alternative Gene Names: FLA8, KIAA0359, KLP-11, Validated applications: ICC, WB, Uniprot ID: O15066, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in tethering...
| Keywords: | Anti-KIF3B, Anti-KIAA0359 |
| Application: | ICC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Anti-KIF3B, NT (KIF3B, KIAA0359, Kinesin-like protein...
Item number: 037442.200
The protein encoded by this gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved...
| Keywords: | Anti-KIF3B, Anti-KIAA0359 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Anti-KIF3B
Item number: ELK-ES19917.100
Protein function: Microtubule-based molecular motor that transport intracellular cargos, such as vesicles, organelles and protein complexes. Uses ATP hydrolysis to generate force to bind and move along the microtubule. Plays a role in cilia formation (PubMed:32386558). Involved in photoreceptor integrity and opsin...
| Keywords: | Anti-KIF3B, Anti-KIAA0359, KIF3B rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
KIF3B (human), recombinant protein
Item number: ABS-PP-6366.100
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
| Keywords: | Kinesin-like protein KIF3B, HH0048, Microtubule plus end-directed kinesin motor 3B) [Cleaved into: Kinesin-like protein... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 19.5 kD |
From 90.00€
*
KIF3B PrEST Antigen
Item number: ATA-APrEST95781.100
PrEST Antigen KIF3B, Gene description: kinesin family member 3B, Alternative Gene Names: FLA8, KIAA0359, KLP-11, Antigen sequence: GEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKMRLLKEKEKKM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in tethering the chromosomes to...
| Keywords: | KIF3B, KIAA0359 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-Klp68D
Item number: CSB-PA343231XA01DLU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-KLP5, Anti-Klp68D, Anti-CG7293, Anti-Kinesin-like protein Klp68D, Klp68D Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Drosophila melanogaster (Fruit fly) |
From 1,529.00€
*
KIF3B (human), recombinant protein
Item number: ABS-PP-6366-L.100
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
| Keywords: | Kinesin-like protein KIF3B, HH0048, Microtubule plus end-directed kinesin motor 3B) [Cleaved into: Kinesin-like protein... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 19.5 kD |
From 115.00€
*