- Search results for O15066
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "O15066"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG41257.50
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
| Keywords: | Anti-KIF3B, Anti-KIAA0359 |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
584.00€
*
Item number: ATA-HPA066525.100
Polyclonal Antibody against Human KIF3B, Gene description: kinesin family member 3B, Alternative Gene Names: FLA8, KIAA0359, KLP-11, Validated applications: ICC, WB, Uniprot ID: O15066, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in tethering...
| Keywords: | Anti-KIF3B, Anti-KIAA0359 |
| Application: | ICC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA066525.25
Polyclonal Antibody against Human KIF3B, Gene description: kinesin family member 3B, Alternative Gene Names: FLA8, KIAA0359, KLP-11, Validated applications: ICC, WB, Uniprot ID: O15066, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in tethering...
| Keywords: | Anti-KIF3B, Anti-KIAA0359 |
| Application: | ICC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: 037442.200
The protein encoded by this gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved...
| Keywords: | Anti-KIF3B, Anti-KIAA0359 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ELK-ES19917.100
Protein function: Microtubule-based molecular motor that transport intracellular cargos, such as vesicles, organelles and protein complexes. Uses ATP hydrolysis to generate force to bind and move along the microtubule. Plays a role in cilia formation (PubMed:32386558). Involved in photoreceptor integrity and opsin...
| Keywords: | Anti-KIF3B, Anti-KIAA0359, KIF3B rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: ABS-PP-6366.100
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
| Keywords: | Kinesin-like protein KIF3B, HH0048, Microtubule plus end-directed kinesin motor 3B) [Cleaved into: Kinesin-like protein... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 19.5 kD |
From 90.00€
*
Item number: ATA-APrEST95781.100
PrEST Antigen KIF3B, Gene description: kinesin family member 3B, Alternative Gene Names: FLA8, KIAA0359, KLP-11, Antigen sequence: GEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKMRLLKEKEKKM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in tethering the chromosomes to...
| Keywords: | KIF3B, KIAA0359 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-6366-L.100
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
| Keywords: | Kinesin-like protein KIF3B, HH0048, Microtubule plus end-directed kinesin motor 3B) [Cleaved into: Kinesin-like protein... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 19.5 kD |
From 115.00€
*