Anti-GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/E

GADD 153 was described as a growth arrest and DNA damage inducible gene that encodes a C/EBP- related nuclear protein. GADD153 expression is induced by a variety of cellular stresses, including nutrient deprivation and metabolic perturbations. GADD153 functions to block cells in G1 to S phase in cell cycle progression and acts by dimerizing with other C/EBP proteins to direct GADD153 dimers away from "classical" C/EBP binding sites, recognizing unique "non-classical" sites instead. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody., Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL , Storage and Stability:, May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.