Anti-Fascin

Anti-Fascin
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32251 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Organizes filamentous actin into bundles... more
Product information "Anti-Fascin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration. [UniProt]Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer. Protein function: Actin-binding protein that contains 2 major actin binding sites (PubMed:21685497, PubMed:23184945). Organizes filamentous actin into parallel bundles (PubMed:20393565, PubMed:21685497, PubMed:23184945). Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers (PubMed:22155786). Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration (PubMed:20393565, PubMed:21685497, PubMed:23184945). Mediates reorganization of the actin cytoskeleton and axon growth cone collapse in response to NGF (PubMed:22155786). [The UniProt Consortium]
Keywords: Anti-p55, Anti-FAN1, Anti-FSCN1, Anti-Fascin, Anti-Singed-like protein, Anti-55 kDa actin-bundling protein, Fascin Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32251

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD of human Fascin
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Fascin"
Write a review
or to review a product.
Viewed