Anti-EN1 (engrailed Homeobox 1)

Anti-EN1 (engrailed Homeobox 1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
245721.100 100 µg - -

3 - 19 business days*

699.00€
 
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila,... more
Product information "Anti-EN1 (engrailed Homeobox 1)"
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq, Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE*, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 245721

Properties

Application: ELISA, IHC, WB
Antibody Type: Monoclonal
Clone: 1F5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: EN1 (NP_001417, 266aa-392aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-EN1 (engrailed Homeobox 1)"
Write a review
or to review a product.
Viewed