Anti-CXCR4

Anti-CXCR4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32743 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CXCR4 (Chemokine,CXC Motif, Receptor 4),... more
Product information "Anti-CXCR4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization. Protein function: Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation (PubMed:10452968, PubMed:28978524, PubMed:18799424, PubMed:24912431). Involved in the AKT signaling cascade (PubMed:24912431). Plays a role in regulation of cell migration, e.g. during wound healing (PubMed:28978524). Acts as a receptor for extracellular ubiquitin, leading to enhanced intracellular calcium ions and reduced cellular cAMP levels (PubMed:20228059). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (PubMed:11276205). Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal- neuron survival. [The UniProt Consortium]
Keywords: Anti-HM89, Anti-LCR1, Anti-FB22, Anti-LAP-3, Anti-NPYRL, Anti-Fusin, Anti-LESTR, Anti-CD184, Anti-CXCR4, Anti-CXC-R4, Anti-CXCR-4, Anti-SDF-1 receptor, Anti-LPS-associated protein 3, Anti-C-X-C chemokine receptor type 4, CXCR4 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32743

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 265-294 (ILLEIIKQGCEFENTVHKWISITEALAFFH) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CXCR4"
Write a review
or to review a product.
Viewed