Anti-ATP2A3 / SERCA3 ATPase

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58372.50	50 µl		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with... more

Close menu

Product information "Anti-ATP2A3 / SERCA3 ATPase"

Protein function: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. [The UniProt Consortium]

Keywords:	Anti-SERCA3, Anti-ATP2A3, EC=7.2.2.10, Anti-Calcium pump 3, Anti-SR Ca(2+)-ATPase 3, Anti-Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58372

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: bovine, rat, dog, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the middle region of Human ATP2A3 / SERCA3 ATPase. (within the following sequence: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS)
MW:	109 kD
Format:	Affinity Purified