| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ARG58316.50 | 50 µg | - | - |
6 - 14 business days* |
551.00€
|
| Keywords: | Anti-ATP2A3, Anti-SERCA3, EC=3.6.3.8, Anti-Calcium pump 3, Anti-SR Ca(2+)-ATPase 3, Anti-Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 |
| Supplier: | Arigo Biolaboratories |
| Supplier-Nr: | ARG58316 |
Properties
| Application: | IHC (paraffin), WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
| Immunogen: | Synthetic peptide corresponding to a sequence at the N-terminus of Human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related Mouse sequence by five amino acids, and from the related Rat sequence by six amino acids |
| MW: | 114 kD |
| Format: | Antigen Affinity Purified |
Database Information
| KEGG ID : | K05853 | Matching products |
| UniProt ID : | Q93084 | Matching products |
| Gene ID : | GeneID 489 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
