Anti-ATP2A1 / SERCA1 ATPase

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58315.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Key regulator of striated muscle performance by acting as the major Ca(2+)... more

Close menu

Product information "Anti-ATP2A1 / SERCA1 ATPase"

Protein function: Key regulator of striated muscle performance by acting as the major Ca(2+) ATPase responsible for the reuptake of cytosolic Ca(2+) into the sarcoplasmic reticulum. Catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. [The UniProt Consortium]

Keywords:	Anti-ATP2A1, Anti-SERCA1, EC=3.6.3.8, Anti-Calcium pump 1, Anti-SR Ca(2+)-ATPase 1, Anti-Endoplasmic reticulum class 1/2 Ca(2+) ATPase, Anti-Sarcoplasmic/endoplasmic reticulum calcium ATPase 1, Anti-Calcium-transporting ATPase sarcoplasmic reticulum type
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58315

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence at the N-terminus of Human SERCA1 ATPase (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related Mouse and Rat sequences by three amino acids
MW:	110 kD
Format:	Antigen Affinity Purified