Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R30155 | 100 µg | - | - |
3 - 10 business days* |
772.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SERCA1, also called ATP2A1, is an enzyme... more
Product information "Anti-ATP2A1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Protein function: Key regulator of striated muscle performance by acting as the major Ca(2+) ATPase responsible for the reuptake of cytosolic Ca(2+) into the sarcoplasmic reticulum. Catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. [The UniProt Consortium]
Keywords: | Anti-ATP2A1, Anti-SERCA1, EC=3.6.3.8, Anti-Calcium pump 1, Anti-SR Ca(2+)-ATPase 1, Anti-Endoplasmic reticulum class 1/2 Ca(2+) ATPase, Anti-Sarcoplasmic/endoplasmic reticulum calcium ATPase 1, Anti-Calcium-transporting ATPase sarcoplasmic reticulum type, |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R30155 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, rat |
Immunogen: | An amino acid sequence from the N-terminus of human ATP2A1 (MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) was used as the immunogen for this ATP2A1 antibody. |
Format: | Purified |
Database Information
KEGG ID : | K05853 | Matching products |
UniProt ID : | O14983 | Matching products |
Gene ID : | GeneID 487 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed