Anti-ASIC2

Anti-ASIC2
%
Discount Promotion
Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

*1
*1 Offer expires 16/12/2024
Item number Size Datasheet Manual SDS Delivery time Quantity Discount Price
ARG58220.50 50 µg - -

6 - 14 business days*

30 %
508.00€
355.60€
 
Protein function: Cation channel with high affinity for sodium, which is gated by extracellular... more
Product information "Anti-ASIC2"
Protein function: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate. [The UniProt Consortium]
Keywords: Anti-MDEG, Anti-BNC1, Anti-ACCN, Anti-ASIC2, Anti-BNaC1, Anti-Brain sodium channel 1, Anti-Acid-sensing ion channel 2, Anti-Mammalian degenerin homolog, Anti-Amiloride-sensitive brain sodium channel, Anti-Amiloride-sensitive cation channel neuronal 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58220

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Synthetic peptide corresponding to aa. 112-147 of Human ACCN1. (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK)
MW: 58 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ASIC2"
Write a review
or to review a product.
Viewed