Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, His-Tag (TNFRSF9

Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation. Source: Recombinant partial protein corresponding to aa24-186 of human Tumor Necrosis Factor Receptor Superfamily Member 9, fused to His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~18.1kD, Biological Activity: The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.