Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
516829.10 | 10 µg | - | - |
3 - 19 business days* |
379.00€
|
||
516829.50 | 50 µg | - | - |
3 - 19 business days* |
682.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.||Source:|Recombinant... more
Product information "Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, His-Tag (TNFRSF9"
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation. Source: Recombinant partial protein corresponding to aa24-186 of human Tumor Necrosis Factor Receptor Superfamily Member 9, fused to His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~18.1kD, Biological Activity: The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: | CD137, CDw137, TNFRSF9, T-cell antigen ILA, 4-1BB ligand receptor, T-cell antigen 4-1BB homolog, Tumor necrosis factor receptor superfamily member 9 |
Supplier: | United States Biological |
Supplier-Nr: | 516829 |
Properties
Conjugate: | No |
Host: | Mammalian cells |
Species reactivity: | human |
MW: | 18.1 kD |
Purity: | >=95% (SDS-PAGE) |
Format: | Lyophilized |
Database Information
KEGG ID : | K05146 | Matching products |
UniProt ID : | Q07011 | Matching products |
Gene ID | GeneID 3604 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed