Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, His-Fc-Tag (TNFRS

Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, His-Fc-Tag (TNFRS
Item number Size Datasheet Manual SDS Delivery time Quantity Price
516831.10 10 µg - -

3 - 19 business days*

416.00€
516831.50 50 µg - -

3 - 19 business days*

682.00€
 
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.||Source:|Recombinant... more
Product information "Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, His-Fc-Tag (TNFRS"
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation. Source: Recombinant partial protein corresponding to aa24-186 of human Tumor Necrosis Factor Receptor Superfamily Member 9, fused to His-Fc-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~44kD, Biological Activity: The ED50 as determined by its ability to bind human TNFSF9 in functional ELISA is less than 50ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: CD137, CDw137, TNFRSF9, T-cell antigen ILA, 4-1BB ligand receptor, T-cell antigen 4-1BB homolog, Tumor necrosis factor receptor superfamily member 9
Supplier: United States Biological
Supplier-Nr: 516831

Properties

Conjugate: No
Host: Mammalian cells
Species reactivity: human
MW: 44 kD
Purity: >=95% (SDS-PAGE)
Format: Lyophilized

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, His-Fc-Tag (TNFRS"
Write a review
or to review a product.
Viewed