TUSC2, Recombinant, Human, aa1-110, GST-Tag (Tumor Suppressor Candidate 2)

May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells. Source: Recombinant protein corresponding to aa1-110 from human TUSC2, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~38.9kD, AA Sequence: GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.