PR10A, Recombinant, Coptis Japonica, aa20-196, His-SUMO-Tag (S-norcoclaurine Synthase 2)

Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and pyruvic acid or 4-hydroxyphenylpyruvate. Source: Recombinant protein corresponding to aa20-196 from coptis japonica PR10A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36kD, AA Sequence: ERLIFNGRPLLHRVTKEETVMLYHELEVAASADEVWSVEGSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPPGQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYMDTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVPLAIMSEAIAKVVLENKHKSSE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.