TNF, Recombinant, Sheep, aa78-234, His-Tag (Tumor Necrosis Factor)

TNF, Recombinant, Sheep, aa78-234, His-Tag (Tumor Necrosis Factor)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375618.20 20 µg - -

3 - 19 business days*

675.00€
375618.100 100 µg - -

3 - 19 business days*

1,045.00€
 
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages... more
Product information "TNF, Recombinant, Sheep, aa78-234, His-Tag (Tumor Necrosis Factor)"
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells. Source: Recombinant protein corresponding to aa78-234 from sheep Tumor Necrosis Factor, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.2kD, AA Sequence: LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: TNF, TNFA
Supplier: United States Biological
Supplier-Nr: 375618

Properties

Conjugate: No
MW: 19,2
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "TNF, Recombinant, Sheep, aa78-234, His-Tag (Tumor Necrosis Factor)"
Write a review
or to review a product.
Viewed