Sigirr, Recombinant, Mouse, aa1-117, His-Tag (Single Ig IL-1-related Receptor)

Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity). Source: Recombinant protein corresponding to aa1-117 from mouse Sigirr, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.7kD, AA Sequence: MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.