Retn, Recombinant, Mouse, aa21-114, His-Tag (Resistin)

Retn, Recombinant, Mouse, aa21-114, His-Tag (Resistin)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375045.20 20 µg - -

3 - 19 business days*

575.00€
375045.100 100 µg - -

3 - 19 business days*

855.00€
 
Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells.... more
Product information "Retn, Recombinant, Mouse, aa21-114, His-Tag (Resistin)"
Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. Source: Recombinant protein corresponding to aa21-114 from mouse Retn, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.2kD, AA Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Retn, ADSF, Fizz3, Resistin, Cysteine-rich secreted protein FIZZ3, Adipose tissue-specific secretory factor, Adipose-specific cysteine-rich secreted protein A12-alpha
Supplier: United States Biological
Supplier-Nr: 375045

Properties

Conjugate: No
MW: 14,2
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Retn, Recombinant, Mouse, aa21-114, His-Tag (Resistin)"
Write a review
or to review a product.
Viewed