Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
I8443-17.10 | 10 µg | - | - |
3 - 19 business days* |
909.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Rat Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells... more
Product information "Interleukin-22 (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF), rat recombinant (rrIL"
Rat Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. It belongs to the IL-10-related cytokine family that consists of six members (IL-10, IL-19, IL-20, IL-22, IL-24/MDA-7 and IL-26/AK155). These proteins share structural homology and some degree of amino acid sequence homology to IL-10. Receptors for these proteins are members of the class II cytokine receptor family. The rat IL-22 coding region corresponding to amino acids 48-179 was deduced from a rat genomic clone (Genbank accession #AC111483). The N-terminal portion was cloned from rat adipocyte first strands using degenerate forward primers based on the human and mouse IL-22 amino acid sequences in two independent PCR reactions. Rat IL-22 cDNA predicts a 179aa residue precursor protein with a putative 33aa signal peptide that is cleaved to generate a 147aa mature protein, which shares ~92% and 79% aa sequence identity with mouse and human IL-22, respectively. IL-22 signals through a heterodimeric receptor complex composed of the IL-22R (CRF2-9) subunit and the b chain of IL-10R. In addition, IL-22 also binds to a secreted member of the class II cytokine receptor family called IL-22BP that acts as a natural IL-22 antagonist. IL-22 upregulates acute-phase reactants in the liver and hepatoma cells. In a rat hepatoma cell line, IL-22 has been shown to activate the Jak/STAT and MAPK signaling pathways. Source: A DNA sequence encoding the putative mature rat Interleukin 22 protein sequence expressed in E. coli. Amino Acid Sequence: MLPINSQCKLEAANFQQPYIVNRTFMLAKEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSIHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLR NACV, Molecular Mass: The methionyl form of recombinant rat IL-22 has a predicted molecular mass of ~16.7kD. Activity: Measured by its ability to induce IL-10 secretion in Colo205 cells. The ED50 is typically 150-750pg/ml., Form: Lyophilized from a 0.2um filtered solution in PBS containing 50ug of BSA/1ug of cytokine. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile PBS, 0.1% HSA or BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplier: | United States Biological |
Supplier-Nr: | I8443-17 |
Properties
Conjugate: | No |
Host: | E.coli |
Species reactivity: | rat |
Format: | Highly Purified |
Database Information
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed