Interleukin-18, Recombinant, Mouse, aa1-192, His-tag (Il18)

Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells. Source: Recombinant protein corresponding to aa1-192 from mouse Interleukin-18, fused to His-tag at N-terminal, expressed in yeast. Molecular Weight: ~24.6kD, AA Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.