IL8, Recombinant, Canine, aa23-101, His-Tag (Interleukin-8)

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. Source: Recombinant protein corresponding to aa23-101 from canine Interleukin-8, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.1kD, AA Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.