IL-1 beta protein(N-His)(active) (recombinant swine)

IL-1 beta protein(N-His)(active) (recombinant swine)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
E-PKSS000002.20 20 µg -

7 - 16 business days*

588.00€
 
Activity: Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect... more
Product information "IL-1 beta protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is 3 ng/mL. Sequence: MAIVPEPAKEVMANYGDNNNDLLFEADGPKEMKCCTQNLDLGSLRNGSIQLQISHQLWNKSIRQMVSVIVAVEKPMKNPSSQAFCDDDQKSIFSFIFEEEPIILETCNDDFVCDANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B- cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T- helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. [The UniProt Consortium]
Keywords: IL1B, IL-1 beta, Interleukin-1 beta, Recombinant Swine IL-1 beta protein(N-His)(active)
Supplier: Elabscience
Supplier-Nr: E-PKSS000002

Properties

Application: Active, Cell culture
Conjugate: No
Host: E.coli
Species reactivity: swine
MW: 31.23 kD
Format: Lyophilized

Handling & Safety

Storage: -80°C
Shipping: 4°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL-1 beta protein(N-His)(active) (recombinant swine)"
Write a review
or to review a product.
Viewed