Fgf15, Recombinant, Mouse, aa26-218, His-SUMO-Tag (Fibroblast Growth Factor 15)

Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression. Source: Recombinant protein corresponding to aa26-218 from mouse Fgf15, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.23kD, AA Sequence: RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.