EPO, Recombinant, Porcine, aa27-194, His-B2M-Tag (Erythropoietin)

EPO, Recombinant, Porcine, aa27-194, His-B2M-Tag (Erythropoietin)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373208.20 20 µg - -

3 - 19 business days*

636.00€
373208.100 100 µg - -

3 - 19 business days*

985.00€
 
Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation... more
Product information "EPO, Recombinant, Porcine, aa27-194, His-B2M-Tag (Erythropoietin)"
Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Source: Recombinant protein corresponding to aa27-194 from porcine EPO, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.6kD, AA Sequence: APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: EPO, Erythropoietin
Supplier: United States Biological
Supplier-Nr: 373208

Properties

Conjugate: No
MW: 32,6
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "EPO, Recombinant, Porcine, aa27-194, His-B2M-Tag (Erythropoietin)"
Write a review
or to review a product.
Viewed