Cxcl14, Recombinant, Mouse, aa23-99, His-Tag (C-X-C Motif Chemokine 14)

Chemotactic for CESS B-cells and THP-1 monocytes, but not T-cells. Source: Recombinant protein corresponding to aa23-99 from mouse C-X-C Motif Chemokine 14, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.4kD, AA Sequence: SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.