Anti-UTS2R / GPR14

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58938.50	50 µl		-	-	6 - 14 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: High affinity receptor for urotensin-2 and urotensin-2B. The activity of this... more

Close menu

Product information "Anti-UTS2R / GPR14"

Protein function: High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system. [The UniProt Consortium]

Keywords:	Anti-UTS2R, Anti-GPR14, Anti-UR-2-R, Anti-UR-II-R, Anti-Urotensin-2 receptor, Anti-Urotensin II receptor, Anti-G-protein coupled receptor 14
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58938

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide from Human UTS2R / GPR14. (within the following region: WGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRP)
MW:	42 kD
Format:	Affinity Purified